PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H01993.1.p
Common NameEUGRSUZ_H01993
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 426aa    MW: 48317 Da    PI: 6.3172
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H01993.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1048.7e-33287342156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k+r++W+peLH+rFvea+eqLGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Eucgr.H01993.1.p 287 KQRRCWSPELHRRFVEALEQLGGAQVATPKQIRELMQVEGLTNDEVKSHLQKYRLH 342
                       79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.47E-18284345IPR009057Homeodomain-like
PROSITE profilePS5129412.811284344IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-30286346IPR009057Homeodomain-like
TIGRFAMsTIGR015579.7E-27287342IPR006447Myb domain, plants
PfamPF002494.7E-8289340IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MRAVFSFSPR ERVPESQRFS PIRPGGTRPS RGTESPEFRP AFEIESPHRE EEEEEDEREG  60
KGREGKGRKS WGREMELSLD LSLAREPRPV SEFFREVSGI PDRDERLSKL DDYVARLEEE  120
MGKIDPFKRE LPLCMLVLND AMERLKEERL QCKEMEFIRP NRNSDKDKRA EVENKDSCDQ  180
RKWMSSPDQN LDQYAAEKNP IEPCSYKKKG GAFLPFGLHR APPKEGKDSS PISRLTLSTP  240
GSMLASPDND NIKKLSFEAP FSTDHEKLQK SPQQAQQHRL QQHQLRKQRR CWSPELHRRF  300
VEALEQLGGA QVATPKQIRE LMQVEGLTND EVKSHLQKYR LHVRRIPSPS AAVENGLSLV  360
QERSGVDHSE LRTSESDSPQ GPLLACASAR AASSAGGGSA EMTDEEENSE GHSWITVLGE  420
KITAH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H01993.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010070500.10.0PREDICTED: uncharacterized protein LOC104457261
TrEMBLA0A059AZA40.0A0A059AZA4_EUCGR; Uncharacterized protein
STRINGVIT_07s0197g00060.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.14e-59G2-like family protein